Apply

Ready to go for it?

AI Apply speeds things up—apply directly if you prefer.

FREE ACCESS
5,000–10,000 jobs/day
JobTailor Logo

See all jobs on JobTailor

Search thousands of fresh jobs every day.

Discover
  • Fresh listings
  • Fast filters
  • No subscription required
Create a free account and start exploring right away.
Saviynt

Senior Customer Success Manager – SMB Scaled Business

Saviynt

Senior Customer Success Manager managing customer loyalty and adoption across SMB accounts. Overseeing a portfolio of 35–38 accounts and driving value-based outcomes with Saviynt's identity platform.

Posted 6/3/2026full-timeRemote • California • 🇺🇸 United StatesSenior💰 $165,000 - $195,000 per yearWebsite

ATS Keywords

Tailor your resume
Applicant Tracking System Keywords

Tip: use these terms in your resume and cover letter to boost ATS matches.

Hard Skills
Identity and Access Management (IAM)cloud IT architecturehybrid IT architectureon-premise IT architectureSaaSprocess improvementdecision-makingplanninganalysisservice excellence
Soft Skills
customer success managementrelationship managementcommunicationproblem-solvingexecutiondrivetenacitydetail-orientedoutcome-based perspectivecollaboration
Tools & Technologies
Zoomwebinarsautomated campaignsdigital enablement channels
Industry Keywords
cybersecuritycompliancecustomer advocacyaccount managementscaled portfoliocustomer healthsubscription renewalup-sellcross-sellcustomer adoption

Tech Stack

Tools & technologies
CloudCyber Security

About the role

Key responsibilities & impact
  • Portfolio Management: Serve as the primary point of contact for a dedicated portfolio of 35–38 Scaled accounts (under $200k ARR) post-implementation, successfully balancing 1-to-many programmatic initiatives with targeted high-impact 1-to-1 engagements.
  • Retention & Renewal: Manage the subscription renewal pipeline for your assigned portfolio and maintain close cognizance of customer health in order to proactively eliminate barriers to adoption and value.
  • Sales Collaboration: Participate with the Sales team to provide a strong customer-focused sales, orientation, and launch engagement process.
  • Account Expansion: Develop deep, trusting relationships with customer key personnel and larger teams to efficiently seek and develop up-sell / cross-sell opportunities across a high-velocity account base.
  • Cross-Functional Coordination: Coordinate and conduct meetings between customers and Saviynt cross-functional teams to solve problems and advance customer adoption; ensure post-meeting follow-ups and action-item completion.
  • Data-Driven Insights: Monitor and identify product utilization trends across your portfolio, providing feedback to Saviynt cross-functional teams to support continuous improvement -- finding ways to better support customer use cases and corporate identity strategies.
  • Partner Alignment: Communicate with implementation Partners supporting Saviynt customers and seek opportunities to improve outcomes and relationships in the context of customer adoption.
  • Scaled Enablement: Plan and deliver education for customers on new features and releases, leveraging webinars, automated campaigns, and digital enablement channels to effectively reach your full portfolio.
  • Customer Advocacy: Act as the voice of the SMB Scaled customer segment and collect feedback to drive continuous improvement across all areas including product.

Requirements

What you’ll need
  • Education: Bachelor's degree in computer science, engineering, or a related field.
  • Domain Expertise: Knowledge and experience in Identity and Access Management (IAM) is valuable; a cybersecurity and/or compliance background is also very valuable.
  • Technical Savvy: Strong knowledge of cloud, hybrid, and on-premise IT architectures and deployment models.
  • Communication: History of being able to understand technical and complex software environments and bridge the gap in terms of communicating those concepts in language meaningful to the business; similarly, being able to translate business needs to potential technical solutions.
  • Experience: 12+ years of experience in customer-facing roles including customer success management, account management, or Professional Services for complex software implementations. Proven experience managing a high-velocity, scaled portfolio (30+ accounts) in the sub-$200k ARR segment is highly preferred.
  • Drive: Tenacious desire to see customers succeed and thrive.
  • SaaS Background: Previous experience within a fast-paced, growing SaaS organization.
  • Relationship Management: Demonstrated ability to manage customer relationships and work through potentially difficult challenges to achieve positive outcomes at scale.
  • Mindset: Cheerful willingness to be a hands-on contributor and stay detail-focused while maintaining an outcome-based perspective across a high volume of accounts.
  • Execution: Experience in process improvement, decision-making, planning, analysis, and service excellence.
  • Availability: Available to customers via Zoom during North America (Pacific) hours.

Benefits

Comp & perks
  • Medical, Dental, Vision, Life Insurance
  • 401K
  • Unlimited PTO
  • Sick Time
  • Holiday Parties
  • Daily Catered Lunches
  • Employee Recognition Programs
  • Team Socials