FREE ACCESS
5,000–10,000 jobs/day

See all jobs on JobTailor
Search thousands of fresh jobs every day.
Discover
- Fresh listings
- Fast filters
- No subscription required
Create a free account and start exploring right away.

Senior Customer Success Manager – SMB Scaled Business
SaviyntSenior Customer Success Manager managing customer loyalty and adoption across SMB accounts. Overseeing a portfolio of 35–38 accounts and driving value-based outcomes with Saviynt's identity platform.
Posted 6/3/2026full-timeRemote • California • 🇺🇸 United StatesSenior💰 $165,000 - $195,000 per yearWebsite
Tech Stack
Tools & technologiesCloudCyber Security
About the role
Key responsibilities & impact- Portfolio Management: Serve as the primary point of contact for a dedicated portfolio of 35–38 Scaled accounts (under $200k ARR) post-implementation, successfully balancing 1-to-many programmatic initiatives with targeted high-impact 1-to-1 engagements.
- Retention & Renewal: Manage the subscription renewal pipeline for your assigned portfolio and maintain close cognizance of customer health in order to proactively eliminate barriers to adoption and value.
- Sales Collaboration: Participate with the Sales team to provide a strong customer-focused sales, orientation, and launch engagement process.
- Account Expansion: Develop deep, trusting relationships with customer key personnel and larger teams to efficiently seek and develop up-sell / cross-sell opportunities across a high-velocity account base.
- Cross-Functional Coordination: Coordinate and conduct meetings between customers and Saviynt cross-functional teams to solve problems and advance customer adoption; ensure post-meeting follow-ups and action-item completion.
- Data-Driven Insights: Monitor and identify product utilization trends across your portfolio, providing feedback to Saviynt cross-functional teams to support continuous improvement -- finding ways to better support customer use cases and corporate identity strategies.
- Partner Alignment: Communicate with implementation Partners supporting Saviynt customers and seek opportunities to improve outcomes and relationships in the context of customer adoption.
- Scaled Enablement: Plan and deliver education for customers on new features and releases, leveraging webinars, automated campaigns, and digital enablement channels to effectively reach your full portfolio.
- Customer Advocacy: Act as the voice of the SMB Scaled customer segment and collect feedback to drive continuous improvement across all areas including product.
Requirements
What you’ll need- Education: Bachelor's degree in computer science, engineering, or a related field.
- Domain Expertise: Knowledge and experience in Identity and Access Management (IAM) is valuable; a cybersecurity and/or compliance background is also very valuable.
- Technical Savvy: Strong knowledge of cloud, hybrid, and on-premise IT architectures and deployment models.
- Communication: History of being able to understand technical and complex software environments and bridge the gap in terms of communicating those concepts in language meaningful to the business; similarly, being able to translate business needs to potential technical solutions.
- Experience: 12+ years of experience in customer-facing roles including customer success management, account management, or Professional Services for complex software implementations. Proven experience managing a high-velocity, scaled portfolio (30+ accounts) in the sub-$200k ARR segment is highly preferred.
- Drive: Tenacious desire to see customers succeed and thrive.
- SaaS Background: Previous experience within a fast-paced, growing SaaS organization.
- Relationship Management: Demonstrated ability to manage customer relationships and work through potentially difficult challenges to achieve positive outcomes at scale.
- Mindset: Cheerful willingness to be a hands-on contributor and stay detail-focused while maintaining an outcome-based perspective across a high volume of accounts.
- Execution: Experience in process improvement, decision-making, planning, analysis, and service excellence.
- Availability: Available to customers via Zoom during North America (Pacific) hours.
Benefits
Comp & perks- Medical, Dental, Vision, Life Insurance
- 401K
- Unlimited PTO
- Sick Time
- Holiday Parties
- Daily Catered Lunches
- Employee Recognition Programs
- Team Socials
ATS Keywords
✓ Tailor your resumeApplicant Tracking System Keywords
Tip: use these terms in your resume and cover letter to boost ATS matches.
Hard Skills & Tools
Identity and Access Management (IAM)cloud IT architecturehybrid IT architectureon-premise IT architectureSaaSprocess improvementdecision-makingplanninganalysisservice excellence
Soft Skills
customer success managementrelationship managementcommunicationproblem-solvingexecutiondrivetenacitydetail-orientedoutcome-based perspectivecollaboration